PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK30089.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family bZIP
Protein Properties Length: 160aa    MW: 18217.2 Da    PI: 6.2369
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK30089.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_137.16.8e-122581359
                XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1  3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59
                el++ +r+ +NRe+ArrsR +K++ ++ L+  v  L+++N +    ++  ++++ ++
  KFK30089.1 25 ELRKRKRMLSNRESARRSRMKKQKLLDDLTAQVNHLKKQNNEIVTSVSITTQHYLTV 81
                68999***********************************98777666666666555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1708.8E-102169No hitNo description
SMARTSM003384.0E-172387IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.8412588IPR004827Basic-leucine zipper domain
PfamPF001703.0E-92567IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.25E-122680No hitNo description
CDDcd147027.64E-172878No hitNo description
PROSITE patternPS0003603045IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009744Biological Processresponse to sucrose
GO:0080149Biological Processsucrose induced translational repression
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 160 aa     Download sequence    Send to blast
MESSSSGTTS SAIQTSSGSE ENLMELRKRK RMLSNRESAR RSRMKKQKLL DDLTAQVNHL  60
KKQNNEIVTS VSITTQHYLT VEAENSVLRA QLDELSHRLE SLNDIIEFLD NNNGSNTMFG  120
QDSSTSDDFL VNQMNINNNM FYMNHHQQSL MASSHDALLY
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12647RKRKRMLSNRESARRSRMKKQK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00470DAPTransfer from AT4G34590Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0539403e-97AF053940.1 Arabidopsis thaliana transcription factor GBF6 (GBF6) mRNA, complete cds.
GenBankAL0230943e-97AL023094.2 Arabidopsis thaliana DNA chromosome 4, BAC clone T4L20 (ESSA project).
GenBankAL1615853e-97AL161585.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 81.
GenBankAY0639793e-97AY063979.1 Arabidopsis thaliana putative bZIP transcription factor ATB2 (At4g34590) mRNA, complete cds.
GenBankAY0963963e-97AY096396.1 Arabidopsis thaliana putative bZIP transcription factor ATB2 (At4g34590) mRNA, complete cds.
GenBankCP0026873e-97CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
GenBankX997473e-97X99747.1 A.thaliana ATB2 gene.
GenBankZ820433e-97Z82043.1 A.thaliana ATB2 gene.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009108719.14e-70PREDICTED: ocs element-binding factor 1-like
SwissprotQ9LZP81e-23BZP53_ARATH; bZIP transcription factor 53
TrEMBLA0A087GJN71e-112A0A087GJN7_ARAAL; Uncharacterized protein
STRINGBra034639.1-P1e-69(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50128154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34590.14e-63G-box binding factor 6